PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G468100.1.p
Common NameLOC101766124, SETIT_002653mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 254aa    MW: 27132.4 Da    PI: 7.0107
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G468100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.73.4e-30127180155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Seita.5G468100.1.p 127 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 180
                         59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.073124183IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-31124185IPR009057Homeodomain-like
SuperFamilySSF466892.69E-19125184IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-24128180IPR006447Myb domain, plants
PfamPF002493.8E-8130179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MGEEAVDDYQ LELLGDEERV MEWETGLPGA DELTPLSQPL VPPGLAAAFR IPPEPGRTLL  60
DVHRASAATV SRLRSSLGSG GGTFQPFLHP NQAAAGGGGG GSAAAAAGRG DEADSSAAAT  120
TANNSKRPRL VWTPQLHKRF VDVVAHLGIK NAVPKTIMQL MNVEGLTREN VASHLQKYRL  180
YVKRMQGLSN EGPSPSDHIF ASTPVPHSLV HEPQAQVPAP TPYFPMGVSV GYHHHHHQYH  240
HAGYPQAYHH ADK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-20126185463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2065786e-90AB206578.1 Oryza sativa Japonica Group OsPCL1 gene for putative transcription factor, complete cds.
GenBankAP0032776e-90AP003277.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0518C01.
GenBankAP0149576e-90AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126096e-90CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971425.10.0PREDICTED: transcription factor PCL1
SwissprotQ94DH35e-93PCL1_ORYSJ; Transcription factor PCL1
TrEMBLK3XL800.0K3XL80_SETIT; Uncharacterized protein
STRINGSi002653m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.16e-58G2-like family protein